"action" : "rerender" ], "context" : "", { "action" : "pulsate" "actions" : [ } var neededkeys = [76, 79, 71, 77, 69, 73, 78]; LITHIUM.Dialog.options['1229417553'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "actions" : [ // just for convenience, you need a login anyways... } }, } "actions" : [ Bitte stelle Deine Daten nicht öffentlich zur Verfügung! "context" : "", "context" : "", }, "event" : "deleteMessage", "context" : "", return; }, }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/61006","ajaxErrorEventName":"LITHIUM:ajaxError","token":"fIrVLo0tHsHYABbITGJKasn3sazTi4QCRfmFGx--DZ8. "componentId" : "forums.widget.message-view", } "actions" : [ "displaySubject" : "true", { { { { { }, } { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); return; }, { "action" : "rerender" $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); } "actions" : [ "useSubjectIcons" : "true", "context" : "", Ich denke, man wird dir das dann wieder gutschreiben. "componentId" : "forums.widget.message-view", "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'VGsCPxi_sZgjoCRs_mnmeXy0fJrVF5a-It1FpcrHrPE. "context" : "envParam:entity", }, { { "actions" : [ "revokeMode" : "true", // We're good so far. { ] }; ] } } "actions" : [ ] { "event" : "markAsSpamWithoutRedirect", } "action" : "rerender" ], ] { "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1995849 .lia-rating-control-passive', '#form_2'); "action" : "pulsate" ;(function($) { "event" : "removeMessageUserEmailSubscription", "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1953343 .lia-rating-control-passive', '#form'); { "actions" : [ "closeEvent" : "LITHIUM:lightboxCloseEvent", LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); "initiatorBinding" : true, { "actions" : [ "context" : "", ] "action" : "addClassName" "event" : "kudoEntity", sessionStorage.setItem("is_scroll", option); }, "kudosLinksDisabled" : "false", "quiltName" : "ForumMessage", ] "action" : "rerender" "action" : "rerender" "componentId" : "forums.widget.message-view", "eventActions" : [ } { { { ], { }, }); "context" : "", "eventActions" : [ "selector" : "#kudosButtonV2_0", "action" : "pulsate" var watching = false; "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", "context" : "", ] "actions" : [ "triggerSelector" : ".lia-panel-dialog-trigger-event-click", LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "eventActions" : [ "context" : "", } "context" : "", "event" : "unapproveMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ ;(function($) { "useSimpleView" : "false", }, LITHIUM.Loader.runJsAttached(); "event" : "kudoEntity", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "linkDisabled" : "false" }, } ] Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" { count++; "truncateBodyRetainsHtml" : "false", }, "actions" : [ { "event" : "MessagesWidgetEditCommentForm", resetMenu(); ] "disallowZeroCount" : "false", watching = true; window.location.replace('/t5/user/userloginpage'); { "actions" : [ }, LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" "context" : "", element.addClass('active'); "action" : "pulsate" "componentId" : "kudos.widget.button", "initiatorBinding" : true, } "action" : "pulsate" "event" : "expandMessage", "event" : "kudoEntity", "componentId" : "forums.widget.message-view", "displaySubject" : "true", { .attr('aria-hidden','false') "actions" : [ "context" : "", "actions" : [ "action" : "rerender" "disableLinks" : "false", }, "actions" : [ { "actions" : [ ] "event" : "editProductMessage", } "action" : "rerender" $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "context" : "", "event" : "approveMessage", ', 'ajax'); "showCountOnly" : "false", "actions" : [ "triggerEvent" : "LITHIUM:triggerDialogEvent", window.location.replace('/t5/user/userloginpage'); "actions" : [ { { { "actions" : [ "componentId" : "kudos.widget.button", }, }, ] "actions" : [ } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useTruncatedSubject" : "true", "event" : "MessagesWidgetEditCommentForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); "initiatorBinding" : true, { "initiatorDataMatcher" : "data-lia-message-uid" }, } }, "context" : "envParam:entity", { "action" : "rerender" }, "context" : "envParam:quiltName,message", } Preislich sehen die Prepaid-Tarife (4 Wochen) wie folgt aus: S mit 3 GB für 9,99 Euro, M mit 5 GB für 14,99 Euro und L mit 7 GB für 19,99 Euro. "action" : "rerender" "triggerEvent" : "click", "}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1855748,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); $(this).next().toggle(); "showCountOnly" : "false", "disallowZeroCount" : "false", "actions" : [ //$('#lia-body').addClass('lia-window-scroll'); }, "action" : "rerender" "event" : "expandMessage", "event" : "MessagesWidgetEditAnswerForm", "actions" : [ "event" : "kudoEntity", "context" : "", { "componentId" : "kudos.widget.button", ] } "action" : "pulsate" }, { } "context" : "", "context" : "envParam:quiltName", }, ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Diesen Thema für aktuellen Benutzer floaten, Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_6f0e1a8886bdee_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/63178&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "ProductAnswerComment", "actions" : [ "disableLinks" : "false", "action" : "rerender" { { var keycodes = { "forceSearchRequestParameterForBlurbBuilder" : "false", }); { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "dialogContentCssClass" : "lia-panel-dialog-content", "showCountOnly" : "false", "event" : "ProductAnswer", //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); "componentId" : "kudos.widget.button", ] "useSimpleView" : "false", "selector" : "#messageview_1", }, } }, "showCountOnly" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ }, } "actions" : [ }); LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "envParam:selectedMessage", "actions" : [ } "action" : "rerender" } { "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", { }); LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'Gx-_Ab-V1ZSpC75AtQtotgwjV889WtTBAlWOsf1c7YI. "useSubjectIcons" : "true", "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.AjaxSupport.ComponentEvents.set({ "accessibility" : false, "initiatorBinding" : true, "parameters" : { "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:quiltName,message,product,contextId,contextUrl", if ( !watching ) { { "context" : "", }, var key = e.keyCode; "context" : "lia-deleted-state", "actions" : [ "useCountToKudo" : "false", ] "action" : "rerender" "context" : "lia-deleted-state", if ( key == neededkeys[0] ) { ] LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; LITHIUM.Dialog({ "useTruncatedSubject" : "true", count = 0; "context" : "", } "event" : "QuickReply", "action" : "rerender" "action" : "rerender" }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1953398 .lia-rating-control-passive', '#form_0'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "accessibility" : false, var position_x = msg.offset(); } "entity" : "1996324", "action" : "rerender" }); "event" : "removeMessageUserEmailSubscription", "message" : "1996114", } "event" : "addMessageUserEmailSubscription", "context" : "", "actions" : [ { Vodafone bietet ab sofort neue beziehungsweise modifizierte Tarifoptionen für seine CallYa-Prepaid-Karten an. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); { }, "event" : "MessagesWidgetMessageEdit", "actions" : [ "truncateBodyRetainsHtml" : "false", LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", }, }); } "initiatorBinding" : true, "truncateBody" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); "actions" : [ // console.log('watching: ' + key); ], "disableLinks" : "false", "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", "message" : "1995849", LITHIUM.AjaxSupport.ComponentEvents.set({ }); var resetMenu = function() { event.stopPropagation(); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); } "context" : "envParam:quiltName,expandedQuiltName", } "parameters" : { "event" : "QuickReply", "actions" : [ LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "actions" : [ "event" : "ProductAnswerComment", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); "actions" : [ "action" : "rerender" "initiatorBinding" : true, }); "action" : "rerender" "event" : "addMessageUserEmailSubscription", "initiatorDataMatcher" : "data-lia-message-uid" "revokeMode" : "true", "context" : "envParam:quiltName", }, //$(window).scroll(function() { ], "event" : "ProductAnswer", event.preventDefault(); } "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "linkDisabled" : "false" "context" : "lia-deleted-state", } { "event" : "QuickReply", // Oops, not the right sequence, lets restart from the top. "action" : "rerender" "truncateBodyRetainsHtml" : "false", "defaultAriaLabel" : "", { "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "action" : "rerender" ] "showCountOnly" : "false", { "context" : "envParam:quiltName", "actions" : [ } "message" : "1953343", }, { ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "buttonDialogCloseAlt" : "Schließen", "context" : "", { { "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", ;(function($) { "context" : "envParam:quiltName,expandedQuiltName", { "context" : "envParam:selectedMessage", "event" : "unapproveMessage", } } { { }, }, } ] "action" : "rerender" "event" : "removeMessageUserEmailSubscription", ] "action" : "rerender" // console.log('watching: ' + key); }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "addClassName" } ] "disableLinks" : "false", "actions" : [ "actions" : [ { ] "actions" : [ LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { { "action" : "rerender" })(LITHIUM.jQuery); ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1854730 .lia-rating-control-passive', '#form'); } { } }, "}); { }, "componentId" : "forums.widget.message-view", "event" : "MessagesWidgetEditCommentForm", ] "action" : "pulsate" "action" : "rerender" $(this).toggleClass("view-btn-open view-btn-close"); Mit 5 GB Highspeed fürs Surfen in Deutschland (danach bis zu 32 Kbit/s) und im EU-Ausland. "actions" : [ Von meinem Prepaid Guthaben sind 5 Euro verschwunden. ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "event" : "deleteMessage", }, "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_6f0e1a894bfd19', 'disableAutoComplete', '#ajaxfeedback_6f0e1a8886bdee_0', 'LITHIUM:ajaxError', {}, 'X863jq57pdV2ohHL00KrRG0VvMumlS8nhP8hIkJFW_I. $(this).next().toggle(); }, "initiatorBinding" : true, watching = false; "disableKudosForAnonUser" : "false", ], { "action" : "pulsate" { "event" : "ProductAnswer", }, "context" : "envParam:quiltName,product,contextId,contextUrl", } if ( key == neededkeys[0] ) { $(document).ready(function(){ if ( watching ) { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1953343}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1953398}}]); } "actions" : [ "event" : "editProductMessage", ] watching = false; "event" : "removeMessageUserEmailSubscription", ] "action" : "rerender" "context" : "envParam:feedbackData", "event" : "RevokeSolutionAction", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName,message,product,contextId,contextUrl", $(document).ready(function(){ "actions" : [ { { "context" : "lia-deleted-state", ] } "event" : "MessagesWidgetEditAnswerForm", .attr('aria-hidden','true') "event" : "removeThreadUserEmailSubscription", ] "buttonDialogCloseAlt" : "Schließen", { }, count = 0; } "parameters" : { { "event" : "ProductAnswer", "action" : "rerender" }, "message" : "1996324", }, }, } ] { "actions" : [ }, ] { "action" : "addClassName" { }, } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1996114 .lia-rating-control-passive', '#form_3'); ;(function($) { "context" : "envParam:quiltName,expandedQuiltName", "context" : "", element.siblings('li').removeClass('active'); ] "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ "event" : "MessagesWidgetAnswerForm", } ] "entity" : "1996324", "actions" : [ } "action" : "rerender" "context" : "envParam:quiltName,message", window.location.replace('/t5/user/userloginpage'); "action" : "rerender" { ], } //}); { "event" : "markAsSpamWithoutRedirect", }); "displayStyle" : "horizontal", $(this).toggleClass("view-btn-open view-btn-close"); "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", })(LITHIUM.jQuery); "actions" : [ "initiatorBinding" : true, LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'vNfouWyx5z8CPgBxnsY1tl6p4EKYHcdC2haMmADHM_I. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1996114,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:quiltName,expandedQuiltName", { { "action" : "rerender" "includeRepliesModerationState" : "false", .attr('aria-expanded','true') ] "actions" : [ "action" : "rerender" }, var clickHandler = function(event) { "truncateBodyRetainsHtml" : "false", }, "selector" : "#messageview_0", ] "eventActions" : [ "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", } "event" : "addMessageUserEmailSubscription", ] } ] "actions" : [ ] } "displayStyle" : "horizontal", } }, { "event" : "markAsSpamWithoutRedirect", { "event" : "addMessageUserEmailSubscription", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:feedbackData", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "event" : "RevokeSolutionAction", "action" : "rerender" ctaHTML += 'Stell Deine Frage'; } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" }); { "actions" : [ }, "action" : "rerender" "action" : "addClassName" } "event" : "deleteMessage", { if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "actions" : [ ] "useCountToKudo" : "false", { "event" : "ProductAnswerComment", "revokeMode" : "true", //$('#lia-body').addClass('lia-window-scroll'); ] $(document).ready(function(){ ], "kudosable" : "true", "action" : "rerender" RSS-Feed abonnieren; Thema als neu kennzeichnen; Thema als gelesen kennzeichnen ; Diesen Thema für aktuellen Benutzer floaten; Lesezeichen; Abonnieren; Drucker-Anzeigeseite; CallYa. // If watching, pay attention to key presses, looking for right sequence. { "parameters" : { } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport.ComponentEvents.set({ { "initiatorBinding" : true, { { }); "triggerEvent" : "click", }, if (typeof(Storage) !== "undefined") { var count = 0; "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ count = 0; } { { ] ] "event" : "deleteMessage", Zudem steigt die Maximalgeschwindigkeit der Mobile Internet-Flat. "event" : "QuickReply", ] { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "envParam:quiltName,message",

Matthes Und Seitz Adresse, Von Rotholz Nach Maria Brettfall, Max Und Moritz Brutal, Romme Karten Lustig, Kieser Training Essen Termin, Casein Vor Dem Schlafen, Von Tausend Und Einem Ziele, Aris Thessaloniki Fans, Kann Man Webex Kostenlos Nutzen?, Bellevue Bad Doberan öffnungszeiten, Globus Sb-warenhaus Standorte,