{ "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", ] "action" : "rerender" "action" : "rerender" ] "event" : "ProductMessageEdit", "truncateBodyRetainsHtml" : "false", "event" : "approveMessage", "event" : "expandMessage", { ] "actions" : [ } "event" : "ProductAnswer", "action" : "pulsate" } "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/67605","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hY0AYu0uIjM6iIWCFJaF_G73wPDidRAs4zts-tiR9l0. "actions" : [ "componentId" : "kudos.widget.button", ] "context" : "", ] "context" : "", } { ] } "useTruncatedSubject" : "true", { "actions" : [ { } "context" : "", } } if ( Number(val) < 1 ) }, { "useSubjectIcons" : "true", "selector" : "#kudosButtonV2_8", "disallowZeroCount" : "false", } ] ] "actions" : [ { "action" : "rerender" } { "actions" : [ "event" : "removeThreadUserEmailSubscription", }); }, ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] } { } "actions" : [ ] { "context" : "", "disableLabelLinks" : "false", { var keycodes = { } "context" : "envParam:selectedMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/67605","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Q8YjH8jQYbOqEwnUvB5fn395Gfyx-T6M6Vy2tad6ZAk. "parameters" : { } "action" : "rerender" } }); ] '; { "context" : "", ] } { "action" : "rerender" "event" : "ProductAnswer", "action" : "rerender" { "action" : "rerender" } "context" : "", }, "actions" : [ "action" : "rerender" "event" : "ProductAnswer", "event" : "editProductMessage", }, "event" : "approveMessage", "actions" : [ ] { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1747330,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", } "action" : "pulsate" "messageViewOptions" : "1111110111111111111110111110100101001101" "triggerEvent" : "click", "action" : "rerender" ], "event" : "ProductAnswerComment", ] "selector" : "#kudosButtonV2_9", }, "actions" : [ element.find('ul').slideUp(); "action" : "rerender" }, "eventActions" : [ "event" : "MessagesWidgetEditAction", "event" : "ProductMessageEdit", } } "event" : "MessagesWidgetEditAction", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "action" : "rerender" "event" : "removeThreadUserEmailSubscription", } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" "event" : "MessagesWidgetEditAction", "context" : "", }, ;(function($) { element.children('ul').slideDown(); "action" : "rerender" { "context" : "", "selector" : "#kudosButtonV2", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "actions" : [ "action" : "rerender" } ] "context" : "", "event" : "unapproveMessage", ] "initiatorDataMatcher" : "data-lia-message-uid" "includeRepliesModerationState" : "false", "action" : "rerender" "disallowZeroCount" : "false", "event" : "unapproveMessage", "event" : "ProductAnswerComment", { "kudosable" : "true", "disableKudosForAnonUser" : "false", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":2802,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFUBBlFXBVMFAhgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUABwABVFxTABQCUlMGSQFXBwtIDwcIV09SB10BBwMBUFUDCwNAThUPVn1bVgB\/AhsIQCFWCFlqVRBJFA1aYAcRQzIHYkFXF09EAxAxJ3shdmcUWwEWIGt9L0JaAUZAVVUARUZueicwckRBXERbBhgPXQ9dQnsteHpgEloUG0Q="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" ] "useTruncatedSubject" : "true", "action" : "rerender" { "truncateBody" : "true", } } ] { { "event" : "ProductAnswerComment", }); }, ] { }, } "actions" : [ "action" : "rerender" "event" : "MessagesWidgetMessageEdit", { Bist du sicher, dass du fortfahren möchtest? }); ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1755785,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, "action" : "rerender" { } } { "action" : "rerender" "actions" : [ } { "event" : "MessagesWidgetAnswerForm", "context" : "", "displaySubject" : "true", "initiatorBinding" : true, "actions" : [ return false; ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "addClassName" "event" : "MessagesWidgetAnswerForm", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useCountToKudo" : "false", Sicher Reise & Internet Käuferschutz Rabatte Notfallservice Bei uns VISA Karte beantragen. } { "kudosable" : "true", LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); "disableLinks" : "false", { ] }); "actions" : [ "context" : "", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ { "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_9', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] { } }, "actions" : [ } }); "context" : "", "action" : "rerender" }, ] "quiltName" : "ForumMessage", "; ;(function($) { }, "actions" : [ "event" : "RevokeSolutionAction", "context" : "", if (1 != val) { { }); function clearWarning(pagerId) { if (isNaN(val) ) ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] }, ] "componentId" : "forums.widget.message-view", "context" : "", "actions" : [ ], "actions" : [ { "context" : "", "; ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); { "displaySubject" : "true", "event" : "kudoEntity", }, }, "showCountOnly" : "false", { } { "action" : "addClassName" ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); disableInput(pagerId); "parameters" : { } "actions" : [ "context" : "lia-deleted-state", LITHIUM.AjaxSupport.useTickets = false; "kudosLinksDisabled" : "false", "disallowZeroCount" : "false", "action" : "rerender" { "context" : "", ', 'ajax'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "event" : "addMessageUserEmailSubscription", $('#vodafone-community-header .lia-search-toggle').click(function() { "event" : "MessagesWidgetAnswerForm", "action" : "rerender" o.innerHTML = "Page must be in a numeric format. { "quiltName" : "ForumMessage", }, "event" : "unapproveMessage", "truncateBody" : "true", }, { { { ] } "initiatorDataMatcher" : "data-lia-message-uid" { }, }, "; ] "action" : "rerender" "action" : "rerender" "kudosable" : "true", } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" { "actions" : [ ] ], ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } ] "event" : "ProductAnswerComment", LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); } "}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1743451,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. // We made it! "action" : "rerender" ;(function($) { ;(function($) { { } { "action" : "rerender" "event" : "ProductAnswer", "actions" : [ "action" : "rerender" { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "action" : "rerender" "actions" : [ { "actions" : [ "actions" : [ ] { "event" : "ProductMessageEdit", "}); function doChecks(pagerId, val) { "action" : "addClassName" { LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/67605","ajaxErrorEventName":"LITHIUM:ajaxError","token":"dXcRutyXPzvi8J-QceagYtHLeD4HHCxT9NPtgwEvTiM. "context" : "", ] "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", { if (doChecks(pagerId, val)) "eventActions" : [ ] "context" : "envParam:quiltName", "context" : "", }, "event" : "MessagesWidgetAnswerForm", LITHIUM.InputEditForm("form_9", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } "actions" : [ { "action" : "rerender" "action" : "rerender" { count = 0; "action" : "rerender" LITHIUM.StarRating('#any_10', false, 1, 'LITHIUM:starRating'); "action" : "rerender" ] { "disableLinks" : "false", "context" : "envParam:quiltName", { { }, return true; { "actions" : [ "action" : "pulsate" } "selector" : "#kudosButtonV2_7", "context" : "", }, "event" : "editProductMessage", "context" : "envParam:quiltName,message", }, "truncateBody" : "true", "selector" : "#kudosButtonV2_5", "actions" : [ "event" : "addThreadUserEmailSubscription", "revokeMode" : "true", }); }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "disableLinks" : "false", "actions" : [ } { { "actions" : [ { }, } "truncateBody" : "true", { "initiatorDataMatcher" : "data-lia-message-uid" "disallowZeroCount" : "false", } "context" : "", "action" : "rerender" "event" : "editProductMessage", "event" : "expandMessage", "event" : "expandMessage", "event" : "approveMessage", "action" : "pulsate" } // --> "event" : "MessagesWidgetEditAction", ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_10","menuItemsSelector":".lia-menu-dropdown-items"}}); } } { "event" : "MessagesWidgetEditCommentForm", } "}); { { "parameters" : { return false; "event" : "MessagesWidgetEditCommentForm", "actions" : [ "event" : "deleteMessage", "context" : "envParam:feedbackData", { { "useTruncatedSubject" : "true", "context" : "", { }, }, } "event" : "addThreadUserEmailSubscription", ] "context" : "", { LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" } "actions" : [ "context" : "", } "action" : "pulsate" } "context" : "envParam:quiltName", Das gilt nicht für CallNow-Transfers. { "event" : "MessagesWidgetCommentForm", PAYBACK Visa Kartenservice Abrechnung für deine PAYBACK Visa Karte. "action" : "rerender" { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1743421 .lia-rating-control-passive', '#form_4'); { "actions" : [ { "actions" : [ LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ { // We're good so far. congstar Prepaid Guthabenstand telefonisch ansagen lassen: Wählen Sie die im Inland kostenfreie Kurzwahl [kundenkundenhotline-festnetz-guthaben]. } // If watching, pay attention to key presses, looking for right sequence. "event" : "kudoEntity", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); "context" : "envParam:feedbackData", "action" : "rerender" "action" : "rerender" ] } { "context" : "envParam:quiltName", "context" : "", "forceSearchRequestParameterForBlurbBuilder" : "false", }, "action" : "rerender" } else { // --> "includeRepliesModerationState" : "false", "actions" : [ }); "actions" : [ LITHIUM.Dialog.options['1429191771'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "dialogKey" : "dialogKey" document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); "actions" : [ } })(LITHIUM.jQuery); "context" : "envParam:quiltName,expandedQuiltName", "event" : "ProductAnswer", { { "action" : "rerender" } }, "action" : "rerender" ] "context" : "envParam:entity", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); } .attr('aria-hidden','true') "context" : "envParam:quiltName", "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1743209 .lia-rating-control-passive', '#form_2'); "action" : "pulsate" ] }, "action" : "pulsate" ] } } "actions" : [ }, } { { if ( Number(val) < 1 ) "actions" : [ { ] $(document).ready(function(){ }, ] }, { { "action" : "rerender" "disallowZeroCount" : "false", "action" : "rerender" }); "actions" : [ "event" : "QuickReply", }, "context" : "envParam:quiltName,expandedQuiltName", ] "action" : "rerender" "event" : "MessagesWidgetEditAction", "action" : "rerender" }, ] "showCountOnly" : "false", "displaySubject" : "true", { } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_2eaba89615e918","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_2eaba89615e918_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/CallYa/thread-id/67605&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"c6_Mvznei-6WxnNHu65M80GpXC497UOqrDpC51JzmGo. { "actions" : [ "showCountOnly" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); { "action" : "rerender" }, }, { "eventActions" : [ "initiatorBinding" : true, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "eventActions" : [ } }, "action" : "rerender" }, "context" : "", "action" : "rerender" expireDate.setDate(expireDate.getDate() + 365*10); "event" : "removeThreadUserEmailSubscription", { { { { "event" : "expandMessage", "actions" : [ "action" : "rerender" "action" : "rerender" ] "actions" : [ ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(document).keydown(function(e) { ] } count++; } "event" : "approveMessage", }, "actions" : [ "context" : "", { } { "action" : "rerender" } "context" : "envParam:quiltName,message", } // If watching, pay attention to key presses, looking for right sequence. }, ] "actions" : [ { { "context" : "", "action" : "rerender" ] kann mir jemand helfen? "actions" : [ ] "useCountToKudo" : "false", "context" : "lia-deleted-state", "event" : "addThreadUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", logmein: [76, 79, 71, 77, 69, 73, 78], } "actions" : [ "actions" : [ "context" : "", "parameters" : { "context" : "", }, ] { ] "parameters" : { function clearWarning(pagerId) { } o.innerHTML = ""; }); } "event" : "addThreadUserEmailSubscription", // If watching, pay attention to key presses, looking for right sequence. "disableLabelLinks" : "false", "revokeMode" : "true", "event" : "AcceptSolutionAction", } { "selector" : "#kudosButtonV2_4", { { ] "actions" : [ Wenn leicht nachvollziehbare Abbuchungen erfolgen wie e.g. "action" : "rerender" }, ] }, { "componentId" : "forums.widget.message-view", watching = false; { "actions" : [ "event" : "AcceptSolutionAction", "displaySubject" : "true", "activecastFullscreen" : false, "action" : "pulsate" } "actions" : [ "context" : "envParam:selectedMessage", "context" : "", { { ], { "action" : "rerender" } ] }, "context" : "", } "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'kg-XFESd0XxgTK2iFCgpGbOAkhvxKjnvTXHf-7cuRkA. "action" : "rerender" })(LITHIUM.jQuery); "event" : "MessagesWidgetMessageEdit", "parameters" : { // console.log('watching: ' + key); } "}); }, ] "actions" : [ "context" : "", "event" : "MessagesWidgetEditAnswerForm", ] } return false; } } ] "kudosable" : "true", "context" : "envParam:feedbackData", ] LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }); ], "event" : "editProductMessage", }, "context" : "", "context" : "", "action" : "rerender" }, } LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); { }); "action" : "rerender" watching = false; }, "actions" : [ "revokeMode" : "true", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { } LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, '7XXb-p5nWKsia569vBad0fxgd1QB1-g-hR27Wt0fFYY. } { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_2eaba89615e918_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/CallYa/thread-id/67605&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"});